PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g052170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 645aa    MW: 71686.1 Da    PI: 4.9417
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g052170.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.32.9e-094114481954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  Sopen01g052170.1 411 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 448
                       554459******************************88 PP

2BELL126.11.3e-40273344172
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       e+qe+q+k +kLls+l+e+d+rY+qy++q+q+v+ssF++vag g+akpYt+lAl++iSrhFrcL+dai++qi
  Sopen01g052170.1 273 EKQEVQNKLTKLLSMLDEIDRRYRQYYHQMQIVVSSFDVVAGDGAAKPYTALALQTISRHFRCLRDAICNQI 344
                       689********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.8E-61195342IPR006563POX domain
PfamPF075267.6E-50201340IPR006563POX domain
PROSITE profilePS5007112.195389452IPR001356Homeobox domain
SMARTSM003898.3E-10392456IPR001356Homeobox domain
CDDcd000865.15E-12392453No hitNo description
SuperFamilySSF466893.72E-17393459IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28395458IPR009057Homeodomain-like
PfamPF059204.3E-18409448IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MATYFPSPSN QRDADQTFQY FRQSLPESYS EASNAPENMM VFMNYSSSGT YSDMLTGTSQ  60
QQHSCIDIPS IGATSSNTSQ QEVLSNLGES RMGIQDFSSW RDSRNEMLAD NFFQVAQNVQ  120
GQGLSLSLGS NIPSGIGISH VQSQNPNQGG GFNMSFGDGD NSQPKEQRNA DYFPPDYPGR  180
DLDAMKGYNS PYGTSSIART IPSSKYLKAA QYLLDEVVSV RKAIKEQNSK KELTKDSREP  240
DLDSKNISSD TPANGGSDPH ESKNNQSELS ATEKQEVQNK LTKLLSMLDE IDRRYRQYYH  300
QMQIVVSSFD VVAGDGAAKP YTALALQTIS RHFRCLRDAI CNQIRASRRS LGEQDASENS  360
KAIGISRLRF VDQHIRQQRA LQQLGMMQQH AWRPQRGLPE SSVSVLRAWL FEHFLHPYPK  420
DSDKIMLARQ TGLTRSQVSN WFINARVRLW KPMVEEMYKE EAGDAKIDSN SSSEVAPRLA  480
SKDSKVEERG ELHQNAASEF GQYNSGQILE SKSNHEADVE MEGASNAETQ SQSGMENQTD  540
EPLPAMDNCT LFQDAFVQSN DRFSGFGSFG SGNVLPNGVS LTLGLQQGEG SNLPMSIETH  600
VSYVPLRADD MYSTAPTTMV PETAEFNCLD SGNRQQPFWL LPSAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B5e-16398456563Homeobox protein Meis2
3k2a_A5e-16398456563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6863790.0EU686379.1 Solanum etuberosum BEL30 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015062660.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLK4B3L10.0K4B3L1_SOLLC; Uncharacterized protein
STRINGSolyc01g109980.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA102052226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-127BEL1-like homeodomain 6